Retinol Binding Protein RBP Antibody

  • Retinol Binding Protein RBP Antibody

    CatalogueID : NBP1-57677

  • Contact Vendor

Target Rbp1
Species Cross Reactivity Canis lupus familiaris, Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym C, Cellular retinol-binding protein, CRBP1CRBP-I, CRBPCellular retinol-binding protein I, CRBPI, CRABP-I, RBPC, retinol binding protein 1, cellular, retinol-binding protein 1, retinol-binding protein 1, cellular
Unit 0.1 mg
Format IgG purified
Concentration LYOPH
NCBI Gene Aliases CRABP-I, CRBP, CRBP1, CRBPI, RBPC
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RBP1(retinol binding protein 1, cellular) The peptide sequence was selected from the middle region of RBP1. Peptide sequence IIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKG