RBP2 Antibody

  • Contact Vendor

Target RBP2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym Cellular retinol-binding protein II, cellular, CRBP2CRBP-II, CRABP-II, retinol binding protein 2, cellular
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases CRABP-II, CRBP2, CRBPII, RBPC2
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVC