RBP7 Antibody

  • Contact Vendor

Target Rbp7
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym Cellular retinoic acid-binding protein 4, Cellular retinoic acid-binding protein IV, CRBP4, CRBPIV, CRABP4, CRABP-IV, MGC70641, putative cellular retinol-binding protein CRBP IV, retinoid-binding protein 7, retinol binding protein 7, cellular, retinoid binding protein 7
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases CRBP4, CRBPIV, MGC70641
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEK