RDH16 Antibody

  • Contact Vendor

Target RDH16
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym EC, EC 1.1.1, EC 1.1, Microsomal NAD+-dependent retinol dehydrogenase 4, retinol dehydrogenase 16, retinol dehydrogenase 16 (all-trans and 13-cis), retinol dehydrogenase 16 (all-trans), RODH4, RoDH-4, RODH-4, SDR9C8, short chain dehydrogenase/reductase family 9C, member 8, Sterol/retinol dehydrogenase
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases RODH-4, SDR9C8
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GVKVAMIEPGYFKTAVTSKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLVT