RGAG1 Antibody

  • Contact Vendor

Target Rgag1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym KIAA1318MGC142230, MAR9, Mar9, MART9, Mart9, retrotransposon gag domain containing 1, retrotransposon gag domain-containing protein 1, tumor antigen BJHCC23, Tumor antigen BJ-HCC-23
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases KIAA1318, MAR9, MART9, MGC142230
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TSTLLMRDTASGVMSCPQMRSLASGALSKPLMTPKASGTMFTEKMTTTASEAMPTLLMRDTVSGALSMPQMTDTASGGLSASLMRDTASGAMSTSQMTATVSGGMSMPLMRAQDPGVMPASLMRAKVSGKMLSQPMSTQDPGGMSM