Retinol Saturase Antibody

  • Contact Vendor

Target RetSat
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym All-trans-13,14-dihydroretinol saturase, all-trans-retinol 13,14-reductase, EC 1.3.99.23, FLJ20296, retinol saturase (all-trans-retinol 13,14-reductase), RetSat
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FLJ20296
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GVSVKKGHELVNIYCPIVVSNAGLFNTYEHLLPGNARCLPGVKQQLGTVRPGLGMTSVFICLRGTKEDLHLPSTNYYVYYDTDMDQAMERYVSMPREEAAEHIPLLFFAFPSAKDPTWE