REXO2 Antibody

  • Contact Vendor

Target Rexo2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym CGI-114, DKFZp566E144, DKFZP566E144, EC 3.1, oligoribonuclease, mitochondrial, RNA exonuclease 2 homolog, RFN, REX2, REX2, RNA exonuclease 2 homolog (S. cerevisiae), SFNMGC111570, Small fragment nuclease, SMFN
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases DKFZp566E144, MGC111570, REX2, RFN, SFN
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:YRIIDVSTVKELCRRWYPEEYEFAPKKAASHRALDDISESIKELQFYRNNIFKKKIDEKKRKIIENGENEKTVS