REXO2 Antibody

  • Contact Vendor

Target Rexo2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym CGI-114, DKFZp566E144, DKFZP566E144, EC 3.1, oligoribonuclease, mitochondrial, RNA exonuclease 2 homolog, RFN, REX2, REX2, RNA exonuclease 2 homolog (S. cerevisiae), SFNMGC111570, Small fragment nuclease, SMFN
Unit 0.1 ml
Format Immunogen affinity purified
Concentration 0.2 mg/ml
NCBI Gene Aliases DKFZp566E144, MGC111570, REX2, RFN, SFN
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMP