RPA70 Antibody

  • Contact Vendor

Target RPA1
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym HSSB, MSTP075, MST075, replication protein A 70 kDa DNA-binding subunit, replication protein A1 (70kD), replication protein A1, 70kDa, REPA1RF-A protein 1, Replication factor A protein 1, RF-A, RP-A, RPA70RP-A p70, Single-stranded DNA-binding protein
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases HSSB, MST075, REPA1, RF-A, RP-A, RPA70
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RPA1(replication protein A1, 70kDa) The peptide sequence was selected from the middle region of RPA1 (NP_002936). Peptide sequence SRGEGKLFSLELVDESGEIRATAFNEQVDKFFPLIEVNKVYYFSKGTLKI