SLC19A1 Antibody

  • Contact Vendor

Target Slc19a1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym CHMD, FOLThuman reduced folate carrier (RFC)10Intestinal folate carrier 1, FLOT1, folate transporter 1, IFC1, IFC-1, Placental folate transporter, REFC, Reduced folate carrier protein, RFC1, RFC, solute carrier family 19 (folate transporter), member 1, Solute carrier family 19 member 1
Unit 0.1 mg
Format IgG purified
Concentration LYOPH
NCBI Gene Aliases CHMD, FOLT, IFC1, REFC, RFC1
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to SLC19A1(solute carrier family 19 (folate transporter), member 1) The peptide sequence was selected from the N terminal of SLC19A1. Peptide sequence MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP