RFC2 Antibody

  • Contact Vendor

Target Rfc2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym A1, A1 40 kDa subunit, Activator 1 40 kDa subunit, Activator 1 subunit 2, MGC3665, replication factor C (activator 1) 2, 40kDa, replication factor C 2, Replication factor C 40 kDa subunit, replication factor C subunit 2, RF-C 40 kDa subunit, RFC40replication factor C (activator 1) 2 (40kD)
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases A1, MGC3665, RFC40
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PAPAFSKAPGSAGHYELPWVEKYRPVKLNEIVGNEDTVSRLEVFAREGNVPNIIIAGPPGTGKTTSILCLARALLGPALKDAMLELNASND