RFC3 Antibody

  • Contact Vendor

Target RFC3
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym A1 38 kDa subunit, Activator 1 38 kDa subunit, Activator 1 subunit 3, MGC5276, replication factor C (activator 1) 3 (38kD), replication factor C (activator 1) 3, 38kDa, Replication factor C 38 kDa subunit, replication factor C subunit 3, RFC, 38 kD subunit, RFC38RF-C 38 kDa subunit
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases MGC5276, RFC38
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LSTVCKKEGLNLPSQLAHRLAEKSCRNLRKALLMCEACRVQQYPFTADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVA