RFC5 Antibody

  • Contact Vendor

Target RFC5
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym Activator 1 36 kDa subunit, Activator 1 subunit 5,36.5 kD subunit, MGC1155, replication factor C (activator 1) 5, 36.5kDa, RFC36replication factor C (activator 1) 5 (36.5kD), RF-C 36 kDa subunit
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases MGC1155, RFC36
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NYLSKIIPALQSRCTRFRFGPLTPELMVPRLEHVVEEEKVDISEDGMKALVTLSSGDMRRALNILQSTNMAFGKVTEETVYTCTGHPLKSDI