RFESD Antibody

  • Contact Vendor

Target RFESD
Species Cross Reactivity Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym Rieske (Fe-S) domain containing, Rieske domain-containing protein
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RFESD(Rieske (Fe-S) domain containing) The peptide sequence was selected from the middle region of RFESD. Peptide sequence VVHDREVVIFYHKGEYHAMDIRCYHSGGPLHLGDIEDFDGRPCIVCPWHK