Radical Fringe Antibody

  • Contact Vendor

Target rfng
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym beta-1,3-N-acetylglucosaminyltransferase radical fringe, EC 2.4.1.222, O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase, radical fringe (Drosophila) homolog, radical fringe homolog, radical fringe homolog (Drosophila), RFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
Unit 0.1 ml
Format Immunogen affinity purified
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:AGFCLSRGLALKMSPWASLGSFMSTAEQVRLPDDCTVGYIVEGLLGARLLHSPLFHSHLENLQRLPPDTLLQQVTLSHGGPENPHNVVNVAGGFSLHQDPTRFKSIHCLLYPDTDWCPRQKQGA