TRIM13 Antibody

  • Contact Vendor

Target Trim13
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym B-cell chronic lymphocytic leukemia tumor suppressor Leu5, CLL-associated RING finger, E3 ubiquitin-protein ligase TRIM13, EC 6.3.2.-, Leukemia-associated protein 5, LEU5CAR, Putative tumor suppressor RFP2, Ret finger protein 2RING finger protein 77, RFP2DLEU5, RNF77Leu5, Tripartite motif-containing protein 13, tripartite motif protein 13, tripartite motif-containing 13, tripartite motif containing 13
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases CAR, DLEU5, LEU5, RFP2, RNF77
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LSRLDTLETSKRKSLQLLTKDSDKVKEFFEKLQHTLDQKKNEILSDFETMKLAVMQAYDPEINKLNTILQEQRMAFNIAEAFKDVSEPIVFLQQMQEFREKIKVIKETPLPPSNLPASPLMKNFDTSQWEDIKLVDVDKLSLP