RFPL2 Antibody

  • Contact Vendor

Target RFPL2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym ret finger protein-like 2, RNF79RING finger protein 79
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases RNF79
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RFPL2(ret finger protein-like 2) The peptide sequence was selected from the C terminal of RFPL2. Peptide sequence VSFFDAESGSHVYTFRSVSAEEPLRPFLAPSVPPNGDQGVLSICPLMNSG