RFPL3 Antibody

  • Contact Vendor

Target RFPL3
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym ret finger protein-like 3
Unit 50 ug
Format Peptide affinity purified
Concentration LYOPH mg/ml
Company Novus Biologicals
Immunogen Synthetic peptides corresponding to RFPL3(ret finger protein-like 3) The peptide sequence was selected from the C terminal of RFPL3. Peptide sequence TVPLTFLLVDRKLQRVGIFLDMGMQNVSFFDAESGSHVYTFRSVSAEEPL.
Gene Name ret finger protein-like 3