NPVF Antibody

  • Contact Vendor

Target Npvf
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym C7orf9, FMRFamide-related peptides, neuropeptide NPVF, neuropeptide VF precursor
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases C7orf9, RFRP
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TANLPLRSGRNMEVSLVRRVPNLPQRFGRTTTAKSVCRMLSDLCQGSMHSPCANDLFYSMTCQHQEIQNPDQ