RFT1 Antibody

  • Contact Vendor

Target RFT1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym DKFZp667J092, FLJ25945, putative endoplasmic reticulum multispan transmembrane protein, requiring fifty three 1 homolog (S. cerevisiae), RFT1 homolog (S. cerevisiae), RFT1, requiring fifty three 1 homolog
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases CDG1N, DKFZp667J092, FLJ25945
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RFT1(RFT1 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of RFT1. Peptide sequence GTQRDWSQTLNLLWLTVPLGVFWSLFLGWIWLQLLEVPDPNVVPHYATGV