RFTN2 Antibody

  • Contact Vendor

Target Rftn2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym C2orf11, chromosome 2 open reading frame 11, FLJ30574, MGC117313, raftlin family member 2, raftlin-2, Raftlin-2, Raft-linking protein 2
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases C2orf11, FLJ30574, MGC117313, Raftlin-2
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RFTN2 (raftlin family member 2) The peptide sequence was selected from the N terminal of RFTN2. Peptide sequence MGCGLRKLEDPDDSSPGKIFSTLKRPQVETKTEFAYEYVLLDFTLQASSN