COP1 Antibody

  • Contact Vendor

Target RFWD2
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym COP1RNF200FLJ10416, Constitutive photomorphogenesis protein 1 homolog, constitutive photomorphogenic protein (COP1), E3 ubiquitin-protein ligase RFWD2, EC 6.3.2.-, hCOP1, putative ubiquitin ligase COP1, ring finger and WD repeat domain 2, RING finger and WD repeat domain protein 2, RING finger protein 200
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases COP1, FLJ10416, RNF200
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PKCNYVVDNIDHLYPNFLVNELILKQKQRFEEKRFKLDHSVSSTNGHRWQIFQDWLGTDQDNLDLANVNLMLELLVQKKKQLEAESHAAQLQILMEFLKVARRNK