RFX3 Antibody

  • Contact Vendor

Target RFX3
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym bA32F11.1, DNA binding protein RFX3, MGC87155, regulatory factor X, 3 (influences HLA class II expression), Regulatory factor X 3, transcription factor RFX3
Unit 0.1 ml
Format Immunogen affinity purified
Concentration 0.05 mg/ml
NCBI Gene Aliases MGC87155, bA32F11.1
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QYMAMRQQPMQQKQRYKPMQKVDGVADGFTGSGQQTGTSVEQTVIAQSQHHQQFLDASRALPEFGEVEISSLPDGTTFEDIKSLQSLYREHCEAILDVVVNLQFSLIEKLWQTFWRYSPSTPTDGTTITESSNLSE