RFX7 Antibody

  • Contact Vendor

Target RFX7
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym DNA-binding protein RFX7, FLJ21104, FLJ12994, Regulatory factor X 7, regulatory factor X domain containing 2, Regulatory factor X domain-containing protein 2, regulatory factor X, 7, RFXDC2MGC131836
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FLJ12994, FLJ21104, MGC131836, RFXDC2
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VVTQHMQSVKQAPKTPQNVPASPGGDRSARHRYPQILPKPANTSALTIRSPTTVLFTSSPIKTAVVPASHMSSLNVVKMTTISLTPSNSNTPLK