RGAG4 Antibody

  • Contact Vendor

Target RGAG4
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym KIAA2001, MART5, retrotransposon gag domain containing 4,6430402L03Rik, retrotransposon gag domain-containing protein 4
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases 6430402L03Rik, KIAA2001, MAR5, MART5
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ISVTQEGSPLHANFPRFLDEIRKEFCGPIPPRVAKKAIRKLKQGHCTLGSYADAFQFLAQFLSWDDCRLQNQFLKGLSEFFRKELLWSTEMADLDELILECVE