TMEM147 Antibody

  • Contact Vendor

Target tmem147
Species Cross Reactivity Rattus norvegicus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym MGC1936, NIFIE14, Protein NIFIE 14, seven transmembrane domain protein, transmembrane protein 147
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases MGC1936, NIFIE14
Company Novus Biologicals
Type Antibody
Immunogen The immunogen for this antibody is Tmem147. Peptide sequence VTYLFVQLCKMLFLATFFPTWEGGIYDFIGEFMKASVDVADLIGLNLVMS