COPS7B Antibody

  • Contact Vendor

Target PCID2
Species Cross Reactivity Rattus norvegicus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym CSN12-like protein, DKFZp686C20226, F10, FLJ11305, FLJ99362, MGC16774, PCI domain containing 2, PCI domain-containing protein 2
Unit 0.05 mg
Format Peptide affinity purified
Concentration Lyoph
NCBI Gene Aliases DKFZp686C20226, F10, FLJ11305, FLJ99362, MGC16774
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptide directed towards the middle region of human RGD1307041. Peptide sequence MLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVG