RGL1 Antibody

  • Contact Vendor

Target RGL1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym KIAA0959, ral guanine nucleotide dissociation stimulator-like 1, RGLRalGDS-like 1
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases KIAA0959, RGL
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PHFPCLQKLLDYLTRMMPGSDPERRAQNLLEQFQKQEVETDNGLPNTISFSLEEEEELEGGESAEFTCFSEDLVAEQLTYMDAQLFKKVVPHHCLGCIWSRRD