RGL3 Antibody

  • Contact Vendor

Target RGL3
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym FLJ00153, FLJ44275, FLJ32585, MGC138163, MGC126805, ral guanine nucleotide dissociation stimulator-like 3, RalGDS-like 3, RalGEF-like protein 3, mouse homolog
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases FLJ00153, FLJ32585, FLJ44275, MGC126805, MGC138163
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VEIKKTAVQDLSFNKNLRAVVSVLGSWLQDHPQDFRDHPAHSDLGSVRTFLGWAAPGSAEAQKAEKLLED