RGL3 Antibody

  • Contact Vendor

Target RGL3
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym FLJ00153, FLJ44275, FLJ32585, MGC138163, MGC126805, ral guanine nucleotide dissociation stimulator-like 3, RalGDS-like 3, RalGEF-like protein 3, mouse homolog
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases FLJ00153, FLJ32585, FLJ44275, MGC126805, MGC138163
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RGL3 (ral guanine nucleotide dissociation stimulator-like 3) The peptide sequence was selected from the middle region of RGL3. Peptide sequence RNFSSLRAILSALQSNPIYRLKRSWGAVSREPLSTFRKLSQIFSDENNHL