RGMB Antibody

  • Contact Vendor

Target RGMB
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym DKFZp434P228, DRG11-responsive axonal guidance and outgrowth of neurite, RGM domain family, member B
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases DKFZp434P228, DRAGON, FLJ90406, MGC86970
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KACRGNLVYHSAVLGISDLMSQRNCSKDGPTSSTNPEVTHDPCNYHSHAGAREHRRGDQNPPSYLFCGLFGDPHLRTFKDNFQTCKVEGAWPLIDNN