Regucalcin Antibody

  • Contact Vendor

Target RGN
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym EC 3.1.1.17, gluconolactonase, Gluconolactonase, GNL, regucalcin (senescence marker protein-30), RCsenescence marker protein-30, Senescence marker protein 30, SMP-30, SMP30regucalcin
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases GNL, RC, SMP30
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMC