PRRG1 Antibody

  • Contact Vendor

Target RGP1
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym RGP1 retrograde golgi transport homolog (S. cerevisiae), retrograde Golgi transport protein RGP1 homolog
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases KIAA0258
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SKSYSYSEVLPIEGPPSFRGQSVKYVYKLTIGCQRVNSPITLLRVPLRVLVLTGLQDVRFPQDEAVAPSSPFLEEDEGGKKDS