RGS10 Antibody

  • Contact Vendor

Target RGS10
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, FC, IHC
Target Species Homo sapiens
Target/Molecule Synonym regulator of G-protein signaling 10, regulator of G-protein signalling 10
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RGS10 (regulator of G-protein signalling 10) The peptide sequence was selected from the middle region of RGS10. Peptide sequence DQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT