RGS11 Antibody

  • Contact Vendor

Target RGS11
Species Cross Reactivity Canis lupus familiaris, Sus scrofa, Oryctolagus cuniculus, Rattus norvegicus, Mus musculus, Bos taurus, Gallus gallus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym regulator of G-protein signalling 11, regulator of G-protein signaling 11, RS11
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases RS11
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RGS11(regulator of G-protein signaling 11) The peptide sequence was selected from the middle region of RGS11. Peptide sequence LRQPHRYVLDDAQLHIYMLMKKDSYPRFLKSDMYKALLAEAGIPLEMKRR