RGS13 Antibody

  • Contact Vendor

Target RGS13
Species Cross Reactivity Canis lupus familiaris, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym MGC17173, regulator of G-protein signalling 13, regulator of G-protein signaling 13
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases MGC17173
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RGS13 (regulator of G-protein signalling 13) The peptide sequence was selected from the middle region of RGS13. Peptide sequence WSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQK