RGS16 Antibody

  • Contact Vendor

Target RGS16
Species Cross Reactivity Canis lupus familiaris, Sus scrofa, Rattus norvegicus, Mus musculus, Bos taurus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym A28-RGS14, A28-RGS14P, hRGS-r, Retinally abundant regulator of G-protein signaling, Retinal-specific RGS, regulator of G-protein signalling 16, regulator of G-protein signaling 16, RGSR, RGS-r, RGS-R
Unit 0.1 mg
Format IgG purified
Concentration LYOPH
NCBI Gene Aliases A28-RGS14, A28-RGS14P, RGS-R
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RGS16 (regulator of G-protein signalling 16) The peptide sequence was selected from the C terminal of RGS16. Peptide sequence DAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT