RGS18 Antibody

  • Contact Vendor

Target RGS18
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications IHC
Target Species Homo sapiens
Target/Molecule Synonym regulator of G-protein signalling 13, regulator of G-protein signaling 18, RGS13regulator of G-protein signalling 18
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases RGS13
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LFFSQINMCESKEKTFFKLIHGSGKEETSKEAKIRAKEKRNRLSLLVQKPEFHEDTRSSRSGHLAKETRVSPEEAVKWGES