RGS19 Antibody

  • Contact Vendor

Target RGS19
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym G alpha interacting protein, GAIPG protein signalling regulator 19, G-alpha-interacting protein, GNAI3IP, guanine nucleotide binding protein alpha inhibiting activity polypeptide 3interacting protein, regulator of G-protein signalling 19, regulator of G-protein signaling 19, RGSGAIP
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases GAIP, RGSGAIP
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RGS19(regulator of G-protein signaling 19) The peptide sequence was selected from the N terminal of RGS19. Peptide sequence PTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSW