RGS22 Antibody

  • Contact Vendor

Target RGS22
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym DKFZp434I092, DKFZP434I092, FLJ40080, FLJ75004, MGC102908, PRTD-NY2, regulator of G-protein signalling 22, regulator of G-protein signaling 22
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases DKFZp434I092, FLJ40080, FLJ75004, MGC102908, PRTD-NY2
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RGS22(regulator of G-protein signaling 22) The peptide sequence was selected from the N terminal of RGS22. Peptide sequence QTVSTFSLPCCVPYNKLKSPAISSVSENFIFDDGVHPRTKKDPSKTNKLI