RGS3 Antibody

  • Contact Vendor

Target RGS3
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym C2PA, FLJ20370, FLJ31516, FLJ90496, PDZ-RGS3, regulator of G-protein signalling 3, regulator of G-protein signaling 3, RGP3
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases C2PA, FLJ20370, FLJ31516, FLJ90496, PDZ-RGS3, RGP3
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptide directed towards the C terminal of human RGS3 Peptide sequence KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL