RGS4 Antibody

  • Contact Vendor

Target RGS4
Species Cross Reactivity Canis lupus familiaris, Oryctolagus cuniculus, Rattus norvegicus, Mus musculus, Bos taurus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym DKFZp761F1924, MGC60244, MGC2124, regulator of G-protein signalling 4, regulator of G-protein signaling 4, RGP4, schizophrenia disorder 9, SCZD9
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases DKFZp761F1924, MGC2124, MGC60244, RGP4, SCZD9
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptide directed towards the C terminal of human RGS4 Peptide sequence EAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASL