RGS4 Antibody

  • Contact Vendor

Target RGS4
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym DKFZp761F1924, MGC60244, MGC2124, regulator of G-protein signalling 4, regulator of G-protein signaling 4, RGP4, schizophrenia disorder 9, SCZD9
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases DKFZp761F1924, MGC2124, MGC60244, RGP4, SCZD9
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENI