RGS5 Antibody

  • Contact Vendor

Target RGS5
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IHC, IF
Target Species Homo sapiens
Target/Molecule Synonym MSTP032, MSTP092, MSTP106, MSTP129, MST092, MST106, MST129, regulator of G-protein signalling 5, regulator of G-protein signaling 5
Unit 0.1 ml
Format Immunogen affinity purified
NCBI Gene Aliases MST092, MST106, MST129, MSTP032, MSTP092, MSTP106, MSTP129
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEP