RGS6 Antibody

  • Contact Vendor

Target RGS6
Species Cross Reactivity Canis lupus familiaris, Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym DKFZp313G1241, FLJ43552, GAP, G protein signaling 6 regulator, GTPase activating protein, H_DJ0283M22.1, H_DJ1108A12.1, MGC142132, regulator of G-protein signalling 6, regulator of G protein signaling 6, regulator of G protein signalling 6, regulator of G-protein signaling 6, S914, WUGSC:H_DJ0283M22.1, WUGSC:H_DJ1108A12.1
Unit 0.05 mg
Format Peptide affinity purified
Concentration LYOPH
NCBI Gene Aliases DKFZp313G1241, FLJ43552, GAP, MGC142132
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RGS6 (regulator of G-protein signalling 6) The peptide sequence was selected from the C terminal of RGS6. Peptide sequence SAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAY