RGS6 Antibody

  • Contact Vendor

Target RGS6
Species Cross Reactivity Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Gallus gallus
Target Tag/Conjugate Unconjugated
Applications ICC, WB, IF
Target Species Homo sapiens
Target/Molecule Synonym DKFZp313G1241, FLJ43552, GAP, G protein signaling 6 regulator, GTPase activating protein, H_DJ0283M22.1, H_DJ1108A12.1, MGC142132, regulator of G-protein signalling 6, regulator of G protein signaling 6, regulator of G protein signalling 6, regulator of G-protein signaling 6, S914, WUGSC:H_DJ0283M22.1, WUGSC:H_DJ1108A12.1
Unit 0.05 mg
Format Immunogen affinity purified
Concentration 1.0 mg/ml
NCBI Gene Aliases DKFZp313G1241, FLJ43552, GAP, MGC142132
Cite This Product Novus Biologicals cat# NB120-14070 RRID:AB_791910
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptide: KSVYGVTEESQAQSPVHVLSQPIRKTTKEDIRKQI, corresponding to amino acids 231-265 of Human RGS6