RGS7 Antibody

  • Contact Vendor

Target RGS7
Species Cross Reactivity Rattus norvegicus, Mus musculus, Bos taurus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym regulator of G-protein signalling 7, regulator of G-protein signaling 7, regulator of G-protein signaling RGS7
Unit 0.1 mg
Format IgG purified
Concentration LYOPH
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptide directed towards the N terminal of mouse Rgs7. Peptide sequence MAQGNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFL