RGS7 Antibody

  • Contact Vendor

Target RGS7
Species Cross Reactivity Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym regulator of G-protein signalling 7, regulator of G-protein signaling 7, regulator of G-protein signaling RGS7
Unit 0.1 ml
Format Immunogen affinity purified
Company Novus Biologicals
Type Antibody
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNVKEPGRYTFEDAQEHIYKLMKSDSYPRFIRSSAYQELLQAKKKGRNIPIFPCHKNCTPTLR