RGS8 Antibody

  • Contact Vendor

Target RGS8
Species Cross Reactivity Canis lupus familiaris, Rattus norvegicus, Mus musculus, Bos taurus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB
Target Species Homo sapiens
Target/Molecule Synonym MGC119067, MGC119068, MGC119069, regulator of G-protein signalling 8, regulator of G-protein signaling 8
Unit 0.1 mg
Format IgG purified
Concentration LYOPH
NCBI Gene Aliases MGC119067, MGC119068, MGC119069
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptide directed towards the N terminal of human RGS8. Peptide sequence NKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATRWADSFDV