RGS9 Antibody

  • Contact Vendor

Target RGS9
Species Cross Reactivity Canis lupus familiaris, Rattus norvegicus, Mus musculus, Homo sapiens
Host Species Oryctolagus cuniculus
Target Tag/Conjugate Unconjugated
Applications WB, IHC
Target Species Homo sapiens
Target/Molecule Synonym MGC26458, PERRSMGC111763, regulator of G-protein signalling 9, regulator of G-protein signaling 9, RGS9L
Unit 0.1 mg
Format IgG purified
Concentration LYOPH
NCBI Gene Aliases MGC111763, MGC26458, PERRS, RGS9L
Company Novus Biologicals
Type Antibody
Immunogen Synthetic peptides corresponding to RGS9 (regulator of G-protein signalling 9) The peptide sequence was selected from the N terminal of RGS9. Peptide sequence MYYQQALMRSTVKSSVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQ